PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04745A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family EIL
Protein Properties Length: 491aa    MW: 52452.7 Da    PI: 6.5608
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04745AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN355.41.8e-17177287143253
                                HHHHHHHHHSSSSSS-TTS--TTT--HHH.H---S--HHHHHHT--TT--......-----GGG--HHHHHHHHHHHHHHTGGG CS
                       EIN3 143 tlgSLLsalmqhcdppqrrfplekgvepP.WWPtGkelwwgelglskdqg.....tppykkphdlkkawkvsvLtavikhmspt 220
                                tl  +Lsalm  c pp r+     g + P WWPtG+e ww       +       + p+   + lk+++kv+vL a +kh++p+
  Oropetium_20150105_04745A 177 TLARMLSALMASCRPPLRQHDARVGAPRPqWWPTGSEPWWIPDV-VVHLPmmpamPVPFAAVKFLKRVHKVAVLVAIVKHLAPD 259
                                67779********************99766**********9544.3333235668899************************** PP

                                HHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTT CS
                       EIN3 221 ieeirelerqskylqdkmsakesfallsvlnqe 253
                                +++i   +r+      +msa e + +   l++e
  Oropetium_20150105_04745A 260 FARIAGAVRRC-----RMSASEAALWNCALENE 287
                                *****999975.....57777777776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.3180.102.6E-30166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.22E-28168287IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048738.8E-20170286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MTATMVGASS CMTSTQQGTR KERVTSWDLH AKRQHCRNNS QAMGTMRPKS VVPIQAPAMA  60
FPFSGVSGAA PRWSTAAALA AESRAAALPV GAHFLQASSV VAASAPKVMT TSVDGIATAA  120
PLVLAHSGGQ LVQVPVCFYG FASVASGSAT DDLAPPRAAI LTLLPLAAAL DRFHSMTLAR  180
MLSALMASCR PPLRQHDARV GAPRPQWWPT GSEPWWIPDV VVHLPMMPAM PVPFAAVKFL  240
KRVHKVAVLV AIVKHLAPDF ARIAGAVRRC RMSASEAALW NCALENEVTS SCIARPVFVL  300
EPQQHGGSRT TDLLPIPSQD AISDGAIFAT TNGMAQHAQT GTIVAPADGY QQVANLASDA  360
HIGDVVSPTP YNNEVHQVAS VEAEPEELEP NQEYRDADTV VFPTSDLLDQ QLEDMLKQWL  420
GNQQADDDLE KLVASGFGKK TNKLSGAAAA GTGGEEQDND RPWYENEEMR RKFAHMPIAT  480
PHSFDCGWYL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-1816928711128ETHYLENE-INSENSITIVE3-like 3 protein
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15037818
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.15e-18ETHYLENE-INSENSITIVE3-like 3